Transcript | Ll_transcript_347233 |
---|---|
CDS coordinates | 119-514 (+) |
Peptide sequence | MAIKTCEVLLMGLAIISFVSVTSAISGTATYYTTYVPSACYGYVDQGTMIGAASDTIWNNGGACGQMYKITCTGATNQGVPQPCKGGSVTVKIVDRCPSPGCQGTIDLSQEAFSAIADINAGKIQIDYTQV* |
ORF Type | complete |
Blastp | EG45-like domain containing protein from Citrus with 57.25% of identity |
---|---|
Blastx | EG45-like domain containing protein from Citrus with 57.25% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414513.1) |
Pfam | Lytic transglycolase (PF03330.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer