Protein coding transcript 66101

• Transcript: Ll_transcript_330607
• CDS coordinates: 207-875 (+)
• Peptide sequence: MEIQENHQQEASWETDSMGSRSTRVAFSGPMSGPLVSNKTRNSSKKSARFKEEEELVEITLDVHDDSVSVQNIRGGDSETALLATRLEKRPSFGVRLRQVSQELKRMTSSKKFDRVDRAKSGAARALKGLKFMAVKNVGAEGWVQVENRFDELAVDDKLPKTRFGQCIGMQESRDFAGELFDALARRRGITSASITKQQLREFWEQITDQSFDSRLQTFFDM*
• ORF Type: complete

Annotations of Ll_transcript_330607

• Blastp: Respiratory burst oxidase homolog protein B from Solanum with 64.65% of identity
• Blastx: Respiratory burst oxidase homolog protein B from Solanum with 64.52% of identity
• Eggnog: NADPH Oxidase(ENOG410XNZY)
• Kegg: Link to kegg annotations (102603596)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440572.1)
• Pfam: Respiratory burst NADPH oxidase (PF08414.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;