Transcript | Ll_transcript_329427 |
---|---|
CDS coordinates | 14-598 (+) |
Peptide sequence | MVSLYSWSCKRSYKNGFVWHDLFEDDLILPARGSEYVLKGSELIDESNSDHFIPISNIEVQSLKQSPEPVSSRSHDEASSSSSLNGKETRNSLKDELSPGKHTGSSDVSPKSSAGKSGPLILHSTEYKICNKTEVLADASTQTEENDYRPDIQKTCTRGVSTDDGSAEPECNRICGAEEPQVKDGSEICRDCAL* |
ORF Type | complete |
Blastp | Protein UPSTREAM OF FLC from Arabidopsis with 59.62% of identity |
---|---|
Blastx | Protein UPSTREAM OF FLC from Arabidopsis with 59.62% of identity |
Eggnog | function DUF966 domain containing protein, expressed(ENOG410YC81) |
Kegg | Link to kegg annotations (AT5G10150) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436292.1) |
Pfam | Domain of unknown function (DUF966) (PF06136.12) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer