Protein coding transcript 66430

• Transcript: Ll_transcript_330700
• CDS coordinates: 3-620 (+)
• Peptide sequence: DRMGRGKIVIRRIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVVIFSSTSKLYDFSSTSMKSVIERYNETKEGHHQLGSSSSEIKYWQKEAAMLRQQLQNLQESHRQIMGEELSGLTVEELQTLENQLEISIHGVRMKKDQILMDEIQELNRKGKIILQENVELKKKVYGTRDGDGTNRKPVLRNDLHTGEELNVTVNLHL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_330700

• Blastp: MADS-box transcription factor 27 from Oryza sativa with 61.29% of identity
• Blastx: MADS-box transcription factor 27 from Oryza sativa with 57.45% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (4329771)
• CantataDB: Link to cantataDB annotations (CNT0001842)
• Mirbase: osa-MIR444f (MI0006978)
• Ncbi protein: Link to NCBI protein (XP_019434280.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;