Protein coding transcript 66452

• Transcript: Ll_transcript_331874
• CDS coordinates: 883-1281 (+)
• Peptide sequence: MGVADHSKNVFMELKQKKAYRYVIFKVDEKKKEVVVEKTGGLAESYDDFTASLPENDCRYAVYDFDFVTSENCQKSKIFFIAWSPSTSRIRAKMLYATSKDRIKHELDGFHYEIQATDPTEMDLEVLRDRAH*
• ORF Type: complete

Annotations of Ll_transcript_331874

• Blastp: Actin-depolymerizing factor 2 from Oryza sativa with 81.06% of identity
• Blastx: Actin-depolymerizing factor from Vitis with 86.13% of identity
• Eggnog: actin-depolymerizing factor(ENOG41122P5)
• Kegg: Link to kegg annotations (4334307)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444463.1)
• Pfam: Cofilin/tropomyosin-type actin-binding protein (PF00241.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;