Transcript | Ll_transcript_331875 |
---|---|
CDS coordinates | 269-667 (+) |
Peptide sequence | MGVADDSQTTFMDLKLKKVYRYVIFKIDESKREVVVEKTGVPAESYDDFAASLPQNDCRYAVFDFDFVTSENCQKSKIFFIAWSPSTSRIRAKMLYATSKDRFIRQLDGVHYEIQATDPTEMDLEVLRDRAN* |
ORF Type | complete |
Blastp | Actin-depolymerizing factor 6 from Arabidopsis with 79.55% of identity |
---|---|
Blastx | Actin-depolymerizing factor 6 from Arabidopsis with 79.14% of identity |
Eggnog | actin-depolymerizing factor(ENOG41122P5) |
Kegg | Link to kegg annotations (AT2G31200) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426548.1) |
Pfam | Cofilin/tropomyosin-type actin-binding protein (PF00241.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer