| Transcript | Ll_transcript_332380 |
|---|---|
| CDS coordinates | 281-709 (+) |
| Peptide sequence | MGLLSSLLGIIGFVIGIPLGLLVGFFIFVYEDTKQVKDPVVRPISELGPKALEELLPEIPLWVKTPDYERVDWLNKFLLDMWPFLDKAICGMIRLTAKPIFAEYIGKYHIKGIEFDKLSLGTLPPTLCGKSFLHLLIFCANI* |
| ORF Type | complete |
| Blastp | Synaptotagmin-1 from Arabidopsis with 55.04% of identity |
|---|---|
| Blastx | Synaptotagmin-1 from Arabidopsis with 58.51% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (AT2G20990) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019451085.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer