Protein coding transcript 66470

• Transcript: Ll_transcript_332372
• CDS coordinates: 182-994 (+)
• Peptide sequence: MDFLGTSDPYVKLTLTGHKLAARTTTIKRRNLNPEWNEKFKLVVKDPQSQVLQLQVYDWDKVGAHDRLGMQLIPLKVLKPYENKEFTLDLLKDTNTNETPNKKNRGQIVVDLTFVPFKEDSMKFGGAMEGYRSKKSGSDVVSDDEVQEGAGLLLLVIQEAEEVEGDHHNNPYAVLTFRGEKKRTKMMRKTRHPRWSEEFEFMLEEPPLHEKIHIEVLSKRRRFSFLSKESLGYVEINLNDVVHNGRINDKYHLIDSKNGAIHLEIRWTFV*
• ORF Type: complete

Annotations of Ll_transcript_332372

• Blastp: Synaptotagmin-3 from Arabidopsis with 62.22% of identity
• Blastx: Synaptotagmin-3 from Arabidopsis with 61.17% of identity
• Eggnog: Domain-Containing protein(COG5038)
• Kegg: Link to kegg annotations (AT5G04220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429073.1)
• Pfam: C2 domain (PF00168.29)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;