Transcript | Ll_transcript_329624 |
---|---|
CDS coordinates | 164-703 (+) |
Peptide sequence | MLSILRMWSTSLLSRTSSSSIYKFMDSSSNGGRSQSQRLLTLAQHLRLYKPPPFPTEEDDDEESSSNSGGKVVSQVGFPESVTPIAQRFRPKKAAVLICLFEGDAGDLRVILTKRSSNLSTHSGEVALPGGKEEEGDKDDADTAKREANEEIGLDPDVVTVLEPFLSKVCVLFLFNTTS* |
ORF Type | complete |
Blastp | Nudix hydrolase 15, mitochondrial from Arabidopsis with 60.12% of identity |
---|---|
Blastx | Nudix hydrolase 15, mitochondrial from Arabidopsis with 67.15% of identity |
Eggnog | Nudix hydrolase(COG0494) |
Kegg | Link to kegg annotations (AT1G28960) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447196.1) |
Pfam | NUDIX domain (PF00293.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer