Protein coding transcript 66482

• Transcript: Ll_transcript_329625
• CDS coordinates: 164-703 (+)
• Peptide sequence: MLSILRMWSTSLLSRTSSSSIYKFMDSSSNGGRSQSQRLLTLAQHLRLYKPPPFPTEEDDDEESSSNSGGKVVSQVGFPESVTPIAQRFRPKKAAVLICLFEGDAGDLRVILTKRSSNLSTHSGEVALPGGKEEEGDKDDADTAKREANEEIGLDPDVVTVLEPFLSKVCVLFLFNTTS*
• ORF Type: complete

Annotations of Ll_transcript_329625

• Blastp: Nudix hydrolase 15, mitochondrial from Arabidopsis with 60.12% of identity
• Blastx: Nudix hydrolase 15, mitochondrial from Arabidopsis with 67.15% of identity
• Eggnog: Nudix hydrolase(COG0494)
• Kegg: Link to kegg annotations (AT1G28960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445728.1)
• Pfam: NUDIX domain (PF00293.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;