Protein coding transcript 66566

• Transcript: Ll_transcript_331818
• CDS coordinates: 45-560 (+)
• Peptide sequence: METPANKLQRPFSMGRQSSMMPERSNDDSAHDGSSASDAALDPAVGLMYMANEGDLDGMEELLDSGIDVNYKDIDGRTALHVAACQSRTDVVDLLLQRGANVDPRDRWGSTPLADAMYYKNHDVVKILEKHGAKPRMAPILVKSDREVPEYEIDPSELDFTNSVCITKVSI*
• ORF Type: complete

Annotations of Ll_transcript_331818

• Blastp: Glutaminase kidney isoform, mitochondrial from Mus with 36.08% of identity
• Blastx: Glutaminase kidney isoform, mitochondrial from Mus with 38.64% of identity
• Eggnog: Glutaminase(COG2066)
• Kegg: Link to kegg annotations (14660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462045.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;