Protein coding transcript 66568

• Transcript: Ll_transcript_331820
• CDS coordinates: 1804-2391 (+)
• Peptide sequence: MNYLHEHRPEAIIHRDLEPSNILRDDSGHLKVADFGVSKLLKVAKTVKEDKPVTSQDTSWRYVAPEIYRNEEYDTKVDVFAFGLILQEMIEGLPPFYPNPENEVPKAYVENKRPPFQASPKLYAYGLKQLIEKCWDEKSSRRPTFRQIIEILEDINYHLAQKRGWKACFPTCTLKGLFKGDRTRPTSKSSRASIR*
• ORF Type: complete

Annotations of Ll_transcript_331820

• Blastp: Probable serine/threonine-protein kinase DDB_G0278521 from Dictyostelium with 38.71% of identity
• Blastx: Serine/threonine-protein kinase HT1 from Arabidopsis with 39.46% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (DDB_G0278521)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462043.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;