Transcript | Ll_transcript_331828 |
---|---|
CDS coordinates | 1711-2220 (+) |
Peptide sequence | MNYLHEHRPEAIIHRDLEPSNILRDDSGHLKVADFGVSKLLKVAKTVKEDKPVTSQDTSWRYVAPEIYRNEEYDTKVDVFAFGLILQEMIEGLPPFYPNPENEVPKAYVENKRPPFQASPKLYAYGLKQLIEKCWDEKSSRRPTFRQIIEILEDINYHLAQKRGWKVFL* |
ORF Type | complete |
Blastp | Probable serine/threonine-protein kinase DDB_G0278521 from Dictyostelium with 38.71% of identity |
---|---|
Blastx | Serine/threonine-protein kinase HT1 from Arabidopsis with 39.46% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (DDB_G0278521) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462043.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer