Transcript | Ll_transcript_331816 |
---|---|
CDS coordinates | 45-560 (+) |
Peptide sequence | METPANKLQRPFSMGRQSSMMPERSNDDSAHDGSSASDAALDPAVGLMYMANEGDLDGMEELLDSGIDVNYKDIDGRTALHVAACQSRTDVVDLLLQRGANVDPRDRWGSTPLADAMYYKNHDVVKILEKHGAKPRMAPILVKSDREVPEYEIDPSELDFTNSVCITKVSI* |
ORF Type | complete |
Blastp | Glutaminase kidney isoform, mitochondrial from Mus with 36.08% of identity |
---|---|
Blastx | Serine/threonine-protein kinase HT1 from Arabidopsis with 36.03% of identity |
Eggnog | Glutaminase(COG2066) |
Kegg | Link to kegg annotations (14660) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462045.1) |
Pfam | Ankyrin repeats (3 copies) (PF12796.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer