Protein coding transcript 6663

• Transcript: Ll_transcript_452242
• CDS coordinates: 190-822 (+)
• Peptide sequence: MKSMENSSYLLTCMVMVLVVVVVNGQPLVPALFIFGDSVVDVGNNNNLVTIVKANFPPYGRDFNNHMSTGRFCNGKLATDYTAENLGFTSYPPAYLSLKSKGTNLLNGANFASAASGYYSATAKLYHAISLNEQLEHFKDCLNILVGVAGKSNASSIISGAIYVLSAGNSDFIQNYYLNPLLYKVYTADQFSDFLVQNYASFIQASLSQP*
• ORF Type: complete

Annotations of Ll_transcript_452242

• Blastp: GDSL esterase/lipase At5g22810 from Arabidopsis with 68.02% of identity
• Blastx: GDSL esterase/lipase At5g22810 from Arabidopsis with 71.04% of identity
• Eggnog: GDSL esterase lipase(COG3240)
• Kegg: Link to kegg annotations (AT5G22810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457946.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;