Protein coding transcript 66674

• Transcript: Ll_transcript_332296
• CDS coordinates: 892-1314 (+)
• Peptide sequence: MVVNMEWGNFWSSHLPRTVYDIDLDAESPNPNDQGFEKMISGMYLGDIVRRVILRMSLDSDLFGPISPKLSVPFILRTPLMAVMHEDDSPDLREVARILNDVFEVNKPDNLSFVPKAEFSIWHDFEHIIGNVTQDCEDIP*
• ORF Type: complete

Annotations of Ll_transcript_332296

• Blastp: Hexokinase-3 from Arabidopsis with 79.41% of identity
• Blastx: Hexokinase-10 from Oryza sativa with 58.56% of identity
• Eggnog: hexokinase(COG5026)
• Kegg: Link to kegg annotations (AT1G50460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003537744.1)
• Pfam: Hexokinase (PF03727.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;