Protein coding transcript 66677

• Transcript: Ll_transcript_332308
• CDS coordinates: 508-1173 (+)
• Peptide sequence: MVVNMEWGNFWSSHLPRTVYDIDLDAESPNPNDQGFEKMISGMYLGDIVRRVILRMSLDSDLFGPISPKLSVPFILRTPLMAVMHEDDSPDLREVARILNDVFEIEDVPLKARKIVVKVCDVVTRRAARLAAAGIVGILKKIGRDGSGGITGGRSRSDMKMKRTVVAIEGGLYSSYTLFREYLHEALVEILGEDIAKHVILKVTEDGSGIGTALLAASYSS*
• ORF Type: complete

Annotations of Ll_transcript_332308

• Blastp: Hexokinase-3 from Arabidopsis with 75.23% of identity
• Blastx: Hexokinase-3 from Arabidopsis with 74.73% of identity
• Eggnog: hexokinase(COG5026)
• Kegg: Link to kegg annotations (AT1G50460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422346.1)
• Pfam: Hexokinase (PF03727.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;