Transcript | Ll_transcript_330898 |
---|---|
CDS coordinates | 510-1829 (+) |
Peptide sequence | MNCLFYWVKHELMEEIEHDKAPILEGRSSQEIEIPVISESLDIVPKTMESYCNSVCAFSRQQNSAAASKELAKSSKKLSGVIVLYVIVMLVEVVGGIKANSLAVISDAAHLLSDIAGFFISLFAVWASGWEATPHQSFGYNRLEVLGAFLSLQLIWVISGFLIYEAIGRILHLNDEVNGMLMFAIAAFGFVLNFIMVVWLGHDHCHHHGFGVSDHNHSHHHHHHSCGDSDSDHADHHSSGRSNHDHGEHHCSGDSNHDHGEHHCSGHSNHGHGKEGVPKINDEEKFGLLSSNESNVLNINLQGAYLHVMVDMIQSVGVMIAGAIIWAKPEWLVVDLMCTLIFSVISLSTTVPMLRNIYGILMERTPSEINIIDLEKGLRSIKGVQVIHDLHVWSITAGKNVLSCHVVAESGISSIDLLAKIKDYCKNTHKIQHVTIQIE* |
ORF Type | complete |
Blastp | Metal tolerance protein 1 from Arabidopsis with 48.7% of identity |
---|---|
Blastx | Metal tolerance protein 1 from Arabidopsis with 49.42% of identity |
Eggnog | cation diffusion facilitator family transporter(COG1230) |
Kegg | Link to kegg annotations (AT2G46800) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449727.1) |
Pfam | Cation efflux family (PF01545.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer