Protein coding transcript 66737

• Transcript: Ll_transcript_329812
• CDS coordinates: 149-736 (+)
• Peptide sequence: MPEFPDSLTPPATNSRTFPVREDCWTEEASSTLVDAWGRRYVELNRGNLRQKDWQDVADAVNALHAHSKKTHRTDVQCKNRIDTIKKKYKIEKARVASSNGVVSSSWPFFERLDSLIGPNFVAKISNSSPSPSPPVALPLLPYRKIQSPVAAPFASAVLPQKRAASVVMDGGYFRRNYSAMAAAAAAAEADDEEEE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_329812

• Blastp: Trihelix transcription factor ASIL2 from Arabidopsis with 50% of identity
• Blastx: Trihelix transcription factor ASIL2 from Arabidopsis with 58.16% of identity
• Eggnog: NA(ENOG410Z419)
• Kegg: Link to kegg annotations (AT3G14180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430561.1)
• Pfam: Myb/SANT-like DNA-binding domain (PF13837.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;