Transcript | Ll_transcript_329813 |
---|---|
CDS coordinates | 274-861 (+) |
Peptide sequence | MSDFPDSMTPPATNHRALPVREDCWTEEASSTLVDAWGRRYVELNRGNLRQKDWQDVADAVNALHAHSKKTHRTDVQCKNRIDTIKKKYKIEKARVASSNGVVSSSWPFFERLDSLIGPNFVAKISNSSPSPSPPVALPLLPYRKIQSPVAAPFASAVLPQKRAASVVMDGGYFRRNYSAMAAAAAAAEADDEEEE |
ORF Type | 3prime_partial |
Blastp | Trihelix transcription factor ASIL2 from Arabidopsis with 50% of identity |
---|---|
Blastx | Trihelix transcription factor ASIL2 from Arabidopsis with 58.16% of identity |
Eggnog | NA(ENOG410Z419) |
Kegg | Link to kegg annotations (AT3G14180) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430561.1) |
Pfam | Myb/SANT-like DNA-binding domain (PF13837.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer