Protein coding transcript 66776

• Transcript: Ll_transcript_329550
• CDS coordinates: 468-767 (+)
• Peptide sequence: MPTKFKGIYKSFKHITQIFVVKEREMEVGHPTDVKHVAHIGLDGLSGSGPSWMDDYETGDFSTSLGNLGGVRDPNPMDMHTSWSSQGMLQSSVVFGYQR*
• ORF Type: complete

Annotations of Ll_transcript_329550

• Blastp: CRIB domain-containing protein RIC10 from Arabidopsis with 63.93% of identity
• Blastx: CRIB domain-containing protein RIC10 from Arabidopsis with 63.93% of identity
• Eggnog: regulation of growth(ENOG410Z01I)
• Kegg: Link to kegg annotations (AT4G04900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451988.1)
• Pfam: P21-Rho-binding domain (PF00786.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;