Protein coding transcript 66786

• Transcript: Ll_transcript_329594
• CDS coordinates: 27-701 (+)
• Peptide sequence: MWSIVTDSIKSFVSNVVHQFIHKDFHEAIARMTIIDAFLFFIVHCIDKLVTWHRLPVFLGLVYLAIRRHLHQEYNLFNVGSTPMGIRFNPFDYPFRTADGKFNDPFNEVAGSQGSFFGRNILPVDQKKTLLKPDPMLVATKLLARRTYKDTGKQFNVIAASWIQFMIHDWIDHLEETSQIELNAPREVASECPLKSFKFYKTKESPTGFYEIKTGSTNIRTPWW*
• ORF Type: complete

Annotations of Ll_transcript_329594

• Blastp: Alpha-dioxygenase 1 from Arabidopsis with 72.69% of identity
• Blastx: Alpha-dioxygenase 1 from Arabidopsis with 72.69% of identity
• Eggnog: prostaglandin G H synthase and cyclooxygenase(ENOG410XPZ3)
• Kegg: Link to kegg annotations (AT3G01420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428264.1)
• Pfam: Animal haem peroxidase (PF03098.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;