Transcript | Ll_transcript_329563 |
---|---|
CDS coordinates | 261-1313 (+) |
Peptide sequence | MDNKRDGSAIYGSNNEVLNKVRSFKDGKMKISKDGELLHNQNGTAISGDVRNSWAGVSTMQALFLQEHNSICDTLKKHYPELEDEELYRHARLVTSAVIAKIHTIDWTVELLKTDTLLAGMHGNWYGLLGKKFKDTFGHVGGSILGGLVGMKKPQNHGVPYSLTEEFVSVYRMHSLLPDNLQLRDISATPGPNKTPPLIKEIPMKNLIGVDGEKTLTEIGIARQIVSMGHQACGALELWNYPLWLRDIIPQNVDGTERHDHVDLSALEIYRDRERSVARYNEFRRAVLLIPISKWEDLTDDKEAIEVLEEVYGDDVEQLDLLVGQMAEKKIKGFAISETAFIIFLLMASR* |
ORF Type | complete |
Blastp | Alpha-dioxygenase 1 from Arabidopsis with 71.97% of identity |
---|---|
Blastx | Alpha-dioxygenase 1 from Arabidopsis with 71.97% of identity |
Eggnog | prostaglandin G H synthase and cyclooxygenase(ENOG410XPZ3) |
Kegg | Link to kegg annotations (AT3G01420) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428264.1) |
Pfam | Animal haem peroxidase (PF03098.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer