Transcript | Ll_transcript_330040 |
---|---|
CDS coordinates | 1850-2410 (+) |
Peptide sequence | MIYYGMTEPGKHLGVAGLGGLGHVAIKFGKAFGLKVTVISSSPNKESEAISKLGADSFLLSTDPAKFKEAIGTMDYIIDTISAVHSLTSLLALLKLNGKLVTVGLPSKPLELPVFPLVMGRKLIGGSNFGGIKETQEMLNFCGKHNIAADIELIKIDQINTAMERLVKSDVKYRFVIDVGNSLSTS* |
ORF Type | complete |
Blastp | Probable mannitol dehydrogenase 1 from Stylosanthes with 87.63% of identity |
---|---|
Blastx | Probable mannitol dehydrogenase 1 from Stylosanthes with 84.72% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464294.1) |
Pfam | Zinc-binding dehydrogenase (PF00107.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer