Transcript | Ll_transcript_330041 |
---|---|
CDS coordinates | 2653-2994 (+) |
Peptide sequence | MDYIIDTISAVHSLTSLLALLKLNGKLVTVGLPSKPLELPVFPLVMGRKLIGGSNFGGIKETQEMLNFCGKHNIAADIELIKIDQINTAMERLVKSDVKYRFVIDVGNSLSTS* |
ORF Type | complete |
Blastp | Probable cinnamyl alcohol dehydrogenase 9 from Arabidopsis with 78.38% of identity |
---|---|
Blastx | Probable mannitol dehydrogenase 1 from Stylosanthes with 83.24% of identity |
Eggnog | alcohol dehydrogenase(COG1064) |
Kegg | Link to kegg annotations (AT4G39330) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464294.1) |
Pfam | Zinc-binding dehydrogenase (PF00107.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer