Protein coding transcript 66875

• Transcript: Ll_transcript_291587
• CDS coordinates: 781-1233 (+)
• Peptide sequence: MRAKVADFGFAKLGPMNSDQTHVSTKVKGTVGYLDPDYMKTNQLTPKSDVYSFGILLLEIVTGRRPMELKKTVEERITLRWAFRKFNEGSFVELVDPLMEEAVNRDVVMKIFDLAFQCAAPVRADRPDMKSVAEQLWTIRADYLKSARRE*
• ORF Type: complete

Annotations of Ll_transcript_291587

• Blastp: Calmodulin-binding receptor-like cytoplasmic kinase 3 from Arabidopsis with 64.63% of identity
• Blastx: Calmodulin-binding receptor-like cytoplasmic kinase 3 from Arabidopsis with 66.87% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G11520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464383.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;