Protein coding transcript 66892

• Transcript: Ll_transcript_292660
• CDS coordinates: 2-487 (+)
• Peptide sequence: FIIRSFSLSSAAFLSDFKTLIFSLCTFSLNLLTNQHTFLPLSLMATEEKENPYEGLGTGGKFRKRPFRRTQTTPYDRPSNSLRNPTINNNNNKKGWFSKVVDPAHRLISYSAHSLFSSLFRKRLPPPQSNASSSGVEIEQDVRVSHQEETVFVSMHASCML*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_292660

• Blastp: Nuclear pore complex protein NUP1 from Arabidopsis with 43.31% of identity
• Blastx: Nuclear pore complex protein NUP1 from Arabidopsis with 43.31% of identity
• Eggnog: nuclear pore complex protein(ENOG410XPV4)
• Kegg: Link to kegg annotations (AT3G10650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427907.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;