Protein coding transcript 66897

• Transcript: Ll_transcript_292661
• CDS coordinates: 184-492 (+)
• Peptide sequence: MDDLLSSISETQNEQQLFALLSRYSGRQLSIRFMVSLLSRQSDWQRSLAILDWINHKARYSPSLFAFNVVIRNVLRANQWQLAHGLFDEMRQMGLSPDRCIF*
• ORF Type: complete

Annotations of Ll_transcript_292661

• Blastp: Pentatricopeptide repeat-containing protein At5g39980, chloroplastic from Arabidopsis with 68.63% of identity
• Blastx: Pentatricopeptide repeat-containing protein At5g39980, chloroplastic from Arabidopsis with 68.7% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT5G39980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438264.1)
• Pfam: PPR repeat (PF01535.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;