Protein coding transcript 67079

• Transcript: Ll_transcript_291375
• CDS coordinates: 1638-2156 (+)
• Peptide sequence: MDHDKTGCQAAPEGPILCTNNCGFFGSAATMNMCSKCHKDMMHKEEQAKLAASSFGNIMNGSSSNSGNEPVVAANVDISVNPIEPKTICAQPSLASGSEESGEAKPKNGPKRCSSCNKRVGLTGFNCRCGSLFCAVHRYSDKHNCSFDYHTAAQDAIAKANPVVKAEKLDKI*
• ORF Type: complete

Annotations of Ll_transcript_291375

• Blastp: Zinc finger A20 and AN1 domain-containing stress-associated protein 8 from Oryza sativa with 67.24% of identity
• Blastx: Zinc finger A20 and AN1 domain-containing stress-associated protein 8 from Oryza sativa with 66.67% of identity
• Eggnog: zinc finger(ENOG4111UWC)
• Kegg: Link to kegg annotations (4341520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458462.1)
• Pfam: A20-like zinc finger (PF01754.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;