| Transcript | Ll_transcript_443915 |
|---|---|
| CDS coordinates | 3-401 (+) |
| Peptide sequence | FSPLFRVQQETIMSQEQPHRPEEKEAIKYGDVFGVKGDIASNVVAPKDAAMMQKAENNMIGKTKKGGAAAAMQSAAMKNEKSGAVGHNDVSKIAGDGGVNLSESNDDTGNSVISESVAGQVPVFHFSTSVIV* |
| ORF Type | 5prime_partial |
| Blastp | Late embryogenesis abundant protein D-34 from Gossypium with 55.17% of identity |
|---|---|
| Blastx | Late embryogenesis abundant protein D-34 from Gossypium with 55.17% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019452233.1) |
| Pfam | Seed maturation protein (PF04927.11) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer