Protein coding transcript 67100

• Transcript: Ll_transcript_292382
• CDS coordinates: 279-854 (+)
• Peptide sequence: MLGGLYVAVVFLGYMNASAVQPIIDIERTVLYREKAAGMYSAFPYAISQVAIEGIYILIQTGVYSVILYSMMGLQWRADKFFWFFYFITTCFLYYTMYGMMAIALTPGYQIAAISMSFFMTLWNLFAGFTIPMTVSNMPLFIYILHIRLRKTRPFSFACHNLYFSPICCSKFLYGGDGSIGFALFLGHSMAL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_292382

• Blastp: ABC transporter G family member 34 from Arabidopsis with 66.15% of identity
• Blastx: ABC transporter G family member 34 from Arabidopsis with 47.77% of identity
• Eggnog: (ABC) transporter(COG0842)
• Kegg: Link to kegg annotations (AT2G36380)
• CantataDB: Link to cantataDB annotations (CNT0001551)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424860.1)
• Pfam: ABC-2 type transporter (PF01061.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;