Protein coding transcript 673

• Transcript: Ll_transcript_443922
• CDS coordinates: 2-301 (+)
• Peptide sequence: DGGMSNSNLCMQTQANIIGIPVDRPSMAETTALGAAIAAGFAVGIWKEFNELKAINQKDRQIFSPAVSKEESEKMFSKWERAVRMCKGWLDPQDERTDN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_443922

• Blastp: Glycerol kinase from Desulfovibrio with 51.69% of identity
• Blastx: Glycerol kinase from Desulfovibrio with 51.69% of identity
• Eggnog: Key enzyme in the regulation of glycerol uptake and metabolism (By similarity)(COG0554)
• Kegg: Link to kegg annotations (DvMF_0809)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003533071.2)
• Pfam: FGGY family of carbohydrate kinases, C-terminal domain (PF02782.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;