| Transcript | Ll_transcript_292687 |
|---|---|
| CDS coordinates | 158-730 (+) |
| Peptide sequence | MAESVSVNMERIYLGGKEHHIPTGCGSVCVIVYGDQDKPALITYPDLALNHVSCFQGLFFCPEAASLLLHNFCIYHISPPGHELGAAAICPHDSIPSLEDLADQIIEILNHFRLGAVMCMGVTAGAYILSLFAIKYRERVLGLILVSPLCKAPSWTEWIFNKVMSNLLYFYGVCGLVKECLLQRYFSMVL* |
| ORF Type | complete |
| Blastp | Pollen-specific protein SF21 from Helianthus with 70.65% of identity |
|---|---|
| Blastx | Pollen-specific protein SF21 from Helianthus with 60.85% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | Link to cantataDB annotations (CNT0002861) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019447993.1) |
| Pfam | Ndr family (PF03096.13) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer