| Transcript | Ll_transcript_292724 |
|---|---|
| CDS coordinates | 199-525 (+) |
| Peptide sequence | MCMGVTAGAYILSLFAIKYRDRVLGLILVSPLCKAPSWTEWIFNKVMSNLLYFYGVCGLLKECLLQRYFSKEVRGNAEVPESEIVQACRKLLDERKSVNILRFLHAINQ |
| ORF Type | 3prime_partial |
| Blastp | Pollen-specific protein SF21 from Helianthus with 66.97% of identity |
|---|---|
| Blastx | Pollen-specific protein SF21 from Helianthus with 66.67% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | Link to cantataDB annotations (CNT0002861) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019436203.1) |
| Pfam | Ndr family (PF03096.13) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer