Transcript | Ll_transcript_290965 |
---|---|
CDS coordinates | 157-792 (+) |
Peptide sequence | MCAPIFGQVYVHSKLIIIDDRVACIGSSNINDRSLLGLRDSEIGVLIEDQEYVDSLMNGKPWKAGKFSYSLRCSLWSEHLGLHTGEISKISDPVADITYNDLWSATAKENARIYHEVFACVPNDHIHSRSALRQSMAQWKEKFGHTTMDFGIAPDKLVCHENGETKVVDPIDRLKSVKGLLVSFPLEFMRDEDLRPAFIESEFYVSPQVYH* |
ORF Type | complete |
Blastp | Phospholipase D zeta 1 from Arabidopsis with 71.08% of identity |
---|---|
Blastx | Phospholipase D zeta 1 from Arabidopsis with 71.08% of identity |
Eggnog | Catalyzes the reversible phosphatidyl group transfer from one phosphatidylglycerol molecule to another to form cardiolipin (CL) (diphosphatidylglycerol) and glycerol (By similarity)(COG1502) |
Kegg | Link to kegg annotations (AT3G16785) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453268.1) |
Pfam | Phospholipase D Active site motif (PF00614.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer