Protein coding transcript 67484

• Transcript: Ll_transcript_293480
• CDS coordinates: 93-404 (+)
• Peptide sequence: MQSVLVPNVSICVGKHRAISTRQRFRVKAMRAVVQRVASASVEVDGRIVSEIGPGLLVLVGIHHSDSDSDADYMFFSTLFSIFSSFFDSNYNYSFFFSDAGRS*
• ORF Type: complete

Annotations of Ll_transcript_293480

• Blastp: D-aminoacyl-tRNA deacylase from Carboxydothermus with 41.67% of identity
• Blastx: D-aminoacyl-tRNA deacylase 1 from Bos with 35.4% of identity
• Eggnog: Hydrolyzes D-tyrosyl-tRNA(Tyr) into D-tyrosine and free tRNA(Tyr). Could be a defense mechanism against a harmful effect of D-tyrosine (By similarity)(COG1490)
• Kegg: Link to kegg annotations (CHY_2222)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425611.1)
• Pfam: D-Tyr-tRNA(Tyr) deacylase (PF02580.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;