Transcript | Ll_transcript_292009 |
---|---|
CDS coordinates | 851-1207 (+) |
Peptide sequence | MAASSSSASLFGFREDQDQNQMNQQHSSSATAAAPTQKKKRNQPGTPNPDAEVIALSPKTLMATNRFICEVCNKGFQREQNLQLHRRGHNLPWKLKQKSTKEPRRKVYLCPEPTCVHHD |
ORF Type | 3prime_partial |
Blastp | Protein indeterminate-domain 4, chloroplastic from Arabidopsis with 88.64% of identity |
---|---|
Blastx | Protein indeterminate-domain 4, chloroplastic from Arabidopsis with 88.64% of identity |
Eggnog | Zinc finger protein(COG5048) |
Kegg | Link to kegg annotations (AT2G02080) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441741.1) |
Pfam | C2H2-type zinc finger (PF13912.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer