Protein coding transcript 67539

• Transcript: Ll_transcript_292544
• CDS coordinates: 2-526 (+)
• Peptide sequence: RITPLDQCLVDYSVLTMRPYMDRASILGDAIEYLRDLKQKVNDLHNELQSVPCGSSGTVTPSSSFHSVPTLPSRVKDELCLSNLSSPKGHSPKVEVRLSEERAINIHMFCARKPGLFLSTMRAIDSLGLEVQQAVISCFNGFALDVFRAEVCRVLFYFPISLFFMFAIIFYFGQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_292544

• Blastp: Transcription factor ICE1 from Arabidopsis with 67.39% of identity
• Blastx: Transcription factor ICE1 from Arabidopsis with 62.75% of identity
• Eggnog: inducer of cbf expression(ENOG4111GT2)
• Kegg: Link to kegg annotations (AT3G26744)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451365.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;