Protein coding transcript 67554

• Transcript: Ll_transcript_292516
• CDS coordinates: 393-1103 (+)
• Peptide sequence: MEVVKNATMWPKCKTSGWVKGKLVGSGSFGTVHLAMSKSTGALFVVKSAHLGAGREALDNEVKILKSLRSSPYIVQCLGTEEEEGQGNNNLNVFMEYMAGGTLADVAHKFGGSLNEEVIRVYTREILLGLKHLHQHGIVHCDLKCKNVLLGSCGNIKLADFGSAIRVTDSKGDNGGLKNCLISVVGGTPLWMAPEVLRNEMLDFAADIWSLGCTVIEMATGTPPWSGEVSNPMAAML
• ORF Type: 3prime_partial

Annotations of Ll_transcript_292516

• Blastp: Mitogen-activated protein kinase kinase kinase NPK1 from Nicotiana with 43.89% of identity
• Blastx: Mitogen-activated protein kinase kinase kinase NPK1 from Nicotiana with 43.44% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107796336)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425774.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;