Protein coding transcript 67597

• Transcript: Ll_transcript_290541
• CDS coordinates: 1-540 (+)
• Peptide sequence: GYNEMADILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMAKLTTEQLSEPGAPEQIMYYHIIPEYQTEESMYNAVRRFGKIRYDSLRLPHKVVAQEADGSVKFGHGDESAYLFDPDIYTDGRISVQGIDGVLFPLEEETNTEQTTTTTTTPLVKVAAKPRRGKLLEVACNMLGAFAQVC*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_290541

• Blastp: Fasciclin-like arabinogalactan protein 15 from Arabidopsis with 85.47% of identity
• Blastx: Fasciclin-like arabinogalactan protein 15 from Arabidopsis with 83.24% of identity
• Eggnog: Beta-Ig-H3 fasciclin(COG2335)
• Kegg: Link to kegg annotations (AT3G52370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444186.1)
• Pfam: Fasciclin domain (PF02469.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;