Protein coding transcript 6760

• Transcript: Ll_transcript_452335
• CDS coordinates: 192-566 (+)
• Peptide sequence: MATKFASLRGTIEKMGSNLGFKRCIHSVPNSPPLAGSIDLGVPSMPQPVLPEYSAPSFSFGGSMELMAVPKKKTSPHKRGIRNGPKALKPIPVIVLCKGCGRVRLPHYYCCSGKPKEGGHEGTK*
• ORF Type: complete

Annotations of Ll_transcript_452335

• Blastp: 50S ribosomal protein L32 from Ochrobactrum with 54.76% of identity
• Blastx: -
• Eggnog: 50s ribosomal protein l32(COG0333)
• Kegg: Link to kegg annotations (Oant_1128)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461406.1)
• Pfam: Ribosomal L32p protein family (PF01783.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;