Protein coding transcript 67638

• Transcript: Ll_transcript_292345
• CDS coordinates: 266-598 (+)
• Peptide sequence: MSLYLVFCSDLYSDNQVTELITHRSTSMSTFVLGVSVGYFMADLGMIFWFFPSLGGYEYVIHHLFSVVAVAYSMLSGEGQLYTYMVLISETTTPGINLRWYLDVAGMKRSK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_292345

• Blastp: Transmembrane protein 56-B from Xenopus with 33.33% of identity
• Blastx: Transmembrane protein 56-B from Xenopus with 31.51% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (379606)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434984.1)
• Pfam: TLC domain (PF03798.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;