Protein coding transcript 67669

• Transcript: Ll_transcript_292576
• CDS coordinates: 47-313 (+)
• Peptide sequence: MFSHVGGSSTELTPNAVQSSSKKLSHVSSGRQPTSLSKFDSTNERMRNLHHRRSEANTKNADKKQFELDLGSILRGEDSRTTLMIKNIP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_292576

• Blastp: Protein MEI2-like 4 from Arabidopsis with 60.87% of identity
• Blastx: Protein MEI2-like 4 from Arabidopsis with 58.33% of identity
• Eggnog: Rna-binding protein(ENOG4111R9F)
• Kegg: Link to kegg annotations (AT5G07290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463986.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;