Transcript | Ll_transcript_292564 |
---|---|
CDS coordinates | 967-1956 (+) |
Peptide sequence | MKFASIPRFHPHSLPEYHGSLPNGSPYNFSSTISNMAPNIGTGSPEVSGSMHIQGMGSTGNIAEFIARGNGSRPHGLYHMWNTSNLHQQHPSNAMLWPKAPSFVNGTGTLCIPQMPSFPGTPSHMLRATHVDHHVGSAPVVTASPWETQRSYLGESPEASGFRLGSLGSAGFHDPWQLQQPDFSSRNMFSHVGGNGTDLMSNSGQGSPKQLSHVFPGRLPMTSMSKFDPINERMRNAYNRRSEANTKNADKKQFELDLGSILRGEDSRTTLMIKNIPNKYTSKMLLVAIDEQCRGTYDFLYLPIDFRNKCNVGYAFINMIDPAQIVPFCQ |
ORF Type | 3prime_partial |
Blastp | Protein MEI2-like 4 from Arabidopsis with 49.85% of identity |
---|---|
Blastx | Protein MEI2-like 4 from Arabidopsis with 45.2% of identity |
Eggnog | Rna-binding protein(ENOG4111R9F) |
Kegg | Link to kegg annotations (AT5G07290) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414899.1) |
Pfam | RNA recognition motif 2 (PF04059.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer