Protein coding transcript 67672

• Transcript: Ll_transcript_292564
• CDS coordinates: 967-1956 (+)
• Peptide sequence: MKFASIPRFHPHSLPEYHGSLPNGSPYNFSSTISNMAPNIGTGSPEVSGSMHIQGMGSTGNIAEFIARGNGSRPHGLYHMWNTSNLHQQHPSNAMLWPKAPSFVNGTGTLCIPQMPSFPGTPSHMLRATHVDHHVGSAPVVTASPWETQRSYLGESPEASGFRLGSLGSAGFHDPWQLQQPDFSSRNMFSHVGGNGTDLMSNSGQGSPKQLSHVFPGRLPMTSMSKFDPINERMRNAYNRRSEANTKNADKKQFELDLGSILRGEDSRTTLMIKNIPNKYTSKMLLVAIDEQCRGTYDFLYLPIDFRNKCNVGYAFINMIDPAQIVPFCQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_292564

• Blastp: Protein MEI2-like 4 from Arabidopsis with 49.85% of identity
• Blastx: Protein MEI2-like 4 from Arabidopsis with 45.2% of identity
• Eggnog: Rna-binding protein(ENOG4111R9F)
• Kegg: Link to kegg annotations (AT5G07290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414899.1)
• Pfam: RNA recognition motif 2 (PF04059.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;