Protein coding transcript 67673

• Transcript: Ll_transcript_292565
• CDS coordinates: 1-549 (+)
• Peptide sequence: VSPWEKQHSYFGESPEASGFHLGSLGSGGFHGSWQLHPPHLSSQMFSHVGGNSTELTSNDVQSSPKQFFPGRHPTSLTKYDFTGEQMRNIYQRRSEANTNNADKKQYELDLGRILRGEDSRTTLMIKNIPNKYTSKMLLVAIDEHCRGSYDFLYLPIDFKNKCNVGYAFINMIDPAQIVPFCQ
• ORF Type: internal

Annotations of Ll_transcript_292565

• Blastp: Protein MEI2-like 4 from Arabidopsis with 63.24% of identity
• Blastx: Protein MEI2-like 4 from Arabidopsis with 63.24% of identity
• Eggnog: Rna-binding protein(ENOG4111R9F)
• Kegg: Link to kegg annotations (AT5G07290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432854.1)
• Pfam: RNA recognition motif 2 (PF04059.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;