Protein coding transcript 67674

• Transcript: Ll_transcript_292566
• CDS coordinates: 1-1005 (+)
• Peptide sequence: QYGDIRTMYTAGKHRGFVMISYYDLRAAQNAKKALQNRSLKSMNLDIHYSIPKGNAPDKDIGHGSLMISGLDSSVLNDELKNIFGFYGDIKGIFDSPEMDHIKFVEFYDVRAAEASLHGLNKIFIAGKQIKIEPFHPKIAACLLQQSQKGQDEPDIGHNLNGNLLVRQKATLSSGAASGGILENGYNQGFQSATELPLNAYIDNNTLFPANSSIHKTARGASTGKSFGICESSSTVDAMKFASIPRFHPHSLPEYHGSLPNGSPYNFSSTISNMAPNIGTGSPEVSGSMHIQGMGSTGNIAEFIARGKYNMLRKFHVLVTYFLTLNGINHILAI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_292566

• Blastp: Protein MEI2-like 2 from Oryza sativa with 57.96% of identity
• Blastx: Protein MEI2-like 4 from Arabidopsis with 55.21% of identity
• Eggnog: Rna-binding protein(ENOG4111R9F)
• Kegg: Link to kegg annotations (4330544)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414899.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF13893.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;