Protein coding transcript 67685

• Transcript: Ll_transcript_293274
• CDS coordinates: 205-1161 (+)
• Peptide sequence: MSERTTRGVVMDMAMMSGLLVLLFFPTLTYSYAPRTPSRLNRFSNYLTKHELWLSQTLDHYSPYDHRKFQQRYYEFLDYFQFPDGPIFLVICGEYSCNGIKNDYIAVLAKKFGAAVVSLEHRYYGKSSPFKSLATENLRYLSSKQALFDLAVFRHYYQDSLNSKLNRTKAENPWFVIGVSYPGALSAWFRLKFPHLTCGSLASSAVVLSVYNYTEFDQQVGESAGAECKAALQETTQLIEQKLATNAKALKKSFNAAELQIDGDFLYFLADAAATSFQYGNPDKVCKPLVEAKKSGEDLVVCFSIWLLLTIEYYKTVT*
• ORF Type: complete

Annotations of Ll_transcript_293274

• Blastp: Probable serine protease EDA2 from Arabidopsis with 63.93% of identity
• Blastx: Probable serine protease EDA2 from Arabidopsis with 63.93% of identity
• Eggnog: protease, serine, 16 (thymus)(ENOG410XSGG)
• Kegg: Link to kegg annotations (AT2G18080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003612122.1)
• Pfam: Serine carboxypeptidase S28 (PF05577.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;