Transcript | Ll_transcript_293263 |
---|---|
CDS coordinates | 2145-2519 (+) |
Peptide sequence | MQDAYTKYVKDYFLGTFGVNIQTYDQKYLKNTAISDDSSTRLWWFQVCTEVAYFQVAPSNDSIRSSKVDTRYHLDLCKNVFGDGIFPAVDATNLYYGGTKIAGLETYLCLNFYVFRFFIYLSYS* |
ORF Type | complete |
Blastp | Probable serine protease EDA2 from Arabidopsis with 53.54% of identity |
---|---|
Blastx | Probable serine protease EDA2 from Arabidopsis with 70.73% of identity |
Eggnog | protease, serine, 16 (thymus)(ENOG410XSGG) |
Kegg | Link to kegg annotations (AT2G18080) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003612122.1) |
Pfam | Serine carboxypeptidase S28 (PF05577.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer