| Transcript | Ll_transcript_427224 |
|---|---|
| CDS coordinates | 2-319 (+) |
| Peptide sequence | FQGQCQVCWIFAGVAAVEGIVKIKTGNLISLSEQQVLDCFAHACNPGWAQIVYKYIIQNNGIGGENDYTYYGSAETCNKTRPLAHIRGFMNVAQNSEKQLQIAVAR |
| ORF Type | internal |
| Blastp | Zingipain-1 from Zingiber with 50.46% of identity |
|---|---|
| Blastx | Zingipain-1 from Zingiber with 50.46% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020238706.1) |
| Pfam | Papain family cysteine protease (PF00112.22) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer