Protein coding transcript 67741

• Transcript: Ll_transcript_293356
• CDS coordinates: 389-781 (+)
• Peptide sequence: MAAVDNEKSGSDGKVRSFCNLSFWQTTHASSSSSSSFTSSTYSSMHSSVHQQSQILQSLDRSTHQPKTTVSSVAKSLLPTRRRLRLDPPNKLYFPYEPGKQVRSAITIKNTCKSHVAFKVRCLYLLFLFF*
• ORF Type: complete

Annotations of Ll_transcript_293356

• Blastp: Vesicle-associated protein 4-3 from Arabidopsis with 61.73% of identity
• Blastx: Vesicle-associated protein 4-2 from Arabidopsis with 80% of identity
• Eggnog: Central component in molecular interactions underlying sperm crawling. Forms an extensive filament system that extends from sperm villipoda, along the leading edge of the pseudopod (By similarity)(COG5066)
• Kegg: Link to kegg annotations (AT4G05060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448982.1)
• Pfam: MSP (Major sperm protein) domain (PF00635.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;