Transcript | Ll_transcript_293356 |
---|---|
CDS coordinates | 389-781 (+) |
Peptide sequence | MAAVDNEKSGSDGKVRSFCNLSFWQTTHASSSSSSSFTSSTYSSMHSSVHQQSQILQSLDRSTHQPKTTVSSVAKSLLPTRRRLRLDPPNKLYFPYEPGKQVRSAITIKNTCKSHVAFKVRCLYLLFLFF* |
ORF Type | complete |
Blastp | Vesicle-associated protein 4-3 from Arabidopsis with 61.73% of identity |
---|---|
Blastx | Vesicle-associated protein 4-2 from Arabidopsis with 80% of identity |
Eggnog | Central component in molecular interactions underlying sperm crawling. Forms an extensive filament system that extends from sperm villipoda, along the leading edge of the pseudopod (By similarity)(COG5066) |
Kegg | Link to kegg annotations (AT4G05060) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448982.1) |
Pfam | MSP (Major sperm protein) domain (PF00635.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer